PDB entry 1dd5

View 1dd5 on RCSB PDB site
Description: crystal structure of thermotoga maritima ribosome recycling factor, rrf
Class: ribosome
Keywords: three-helix bundle, beta-alpha-beta sandwich
Deposited on 1999-11-08, released 1999-12-22
The last revision prior to the SCOP 1.75 freeze date was dated 2002-11-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.23
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome recycling factor
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dd5a_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dd5A (A:)
    mvnpfikeakekmkrtlekiedelrkmrtgkpspaileeikvdyygvptpvnqlatisis
    eertlvikpwdksvlsliekainasdlglnpindgnvirlvfpsptteqrekwvkkakei
    veegkiairnirreilkkikedqkeglipeddakrleneiqkltdefiekldevfeikke
    eimef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dd5A (A:)
    vnpfikeakekmkrtlekiedelrkmrtgkpspaileeikvdyygvptpvnqlatisise
    ertlvikpwdksvlsliekainasdlglnpindgnvirlvfpsptteqrekwvkkakeiv
    eegkiairnirreilkkikedqkeglipeddakrleneiqkltdefiekldevfeikkee
    imef