PDB entry 1dd5

View 1dd5 on RCSB PDB site
Description: crystal structure of thermotoga maritima ribosome recycling factor, rrf
Deposited on 1999-11-08, released 1999-12-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.23
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dd5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd5A (A:)
    vnpfikeakekmkrtlekiedelrkmrtgkpspaileeikvdyygvptpvnqlatisise
    ertlvikpwdksvlsliekainasdlglnpindgnvirlvfpsptteqrekwvkkakeiv
    eegkiairnirreilkkikedqkeglipeddakrleneiqkltdefiekldevfeikkee
    imef