PDB entry 1dd4

View 1dd4 on RCSB PDB site
Description: Crystal structure of ribosomal protein l12 from thermotoga maritim
Class: ribosome
Keywords: dimer formation, flexibility, hinge region, four-helix-bundle, five-helix- bundle, alpha-beta structure, helical hairpin, domains, ribosome
Deposited on 1999-11-08, released 2000-11-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dd4a1, d1dd4a2
  • Chain 'B':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dd4b1, d1dd4b2
  • Chain 'C':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dd4c_
  • Chain 'D':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dd4d_
  • Heterogens: TBR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd4A (A:)
    mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefd
    vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkklee
    agaevelk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd4B (B:)
    mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefd
    vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkklee
    agaevelk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dd4C (C:)
    mtideiieaiekltvselaelvkkledkfgvtaaapvava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dd4C (C:)
    mtideiieaiekltvselaelvkkledkfgvtaaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd4D (D:)
    mtideiieaiekltvselaelvkkledkfgvtaaapvava