PDB entry 1dcm

View 1dcm on RCSB PDB site
Description: structure of unphosphorylated fixj-n with an atypical conformer (monomer a)
Class: transcription
Keywords: doubly wound five-stranded beta/alpha fold, nitrogen fixation regulation, transcription
Deposited on 1999-11-05, released 2000-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulatory protein fixj
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcma_
  • Chain 'B':
    Compound: transcriptional regulatory protein fixj
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcmb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dcmA (A:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlvale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcmA (A:)
    dytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdmsg
    vellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierasehl
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dcmB (B:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlvale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcmB (B:)
    dytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdmsg
    vellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierasehl
    v