PDB entry 1dcl

View 1dcl on RCSB PDB site
Description: mcg, a lambda v type light-chain dimer (bence-jones protein), crystallized from ammonium sulfate
Deposited on 1995-10-16, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.14
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dclA (A:)
    psaltqppsasgslgqsvtisctgtssnvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dclB (B:)
    psaltqppsasgslgqsvtisctgtssnvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs