PDB entry 1dcf

View 1dcf on RCSB PDB site
Description: crystal structure of the receiver domain of the ethylene receptor of arabidopsis thaliana
Class: transferase
Keywords: beta-alpha five sandwich, transferase
Deposited on 1999-11-04, released 2000-01-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: etr1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49333 (0-End)
      • conflict (0-1)
    Domains in SCOPe 2.02: d1dcfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dcfA (A:)
    hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
    pgvenyqialrihekftkqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnir
    dvlsdlleprvlyegm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcfA (A:)
    hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
    pgvenyqialrihekftqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnird
    vlsdlleprvlye