PDB entry 1dby

View 1dby on RCSB PDB site
Description: nmr structures of chloroplast thioredoxin m ch2 from the green alga chlamydomonas reinhardtii
Deposited on 1999-11-03, released 1999-11-08
The last revision prior to the SCOP 1.67 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: NMR28
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1dbya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbyA (A:)
    meagavnddtfknvvlessvpvlvdfwapwcgpcriiapvvdeiageykdklkcvklntd
    espnvaseygirsiptimvfkggkkcetiigavpkativqtvekyln