PDB entry 1dbw

View 1dbw on RCSB PDB site
Description: crystal structure of fixj-n
Class: transcription
Keywords: doubly wound five-stranded beta/alpha fold, nitrogen fixation regulation
Deposited on 1999-11-03, released 1999-11-26
The last revision prior to the SCOP 1.75 freeze date was dated 2000-01-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulatory protein fixj
    Species: Rhizobium meliloti
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10958 (0-End)
      • engineered (1)
    Domains in SCOP 1.75: d1dbwa_
  • Chain 'B':
    Compound: transcriptional regulatory protein fixj
    Species: Rhizobium meliloti
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10958 (0-End)
      • engineered (1)
      • engineered (124)
    Domains in SCOP 1.75: d1dbwb_
  • Heterogens: 15P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbwA (A:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlvale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbwA (A:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dbwB (B:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlvale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbwB (B:)
    mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
    sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
    hlval