PDB entry 1db9

View 1db9 on RCSB PDB site
Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Deposited on 1999-11-02, released 2001-11-16
The last revision prior to the SCOP 1.63 freeze date was dated 2001-12-07, with a file datestamp of 2001-12-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.26
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1db9A (A:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsrdtvgril
    kmledqnlisahgktivvyg