PDB entry 1daz

View 1daz on RCSB PDB site
Description: Structural and kinetic analysis of drug resistant mutants of HIV-1 protease
Deposited on 1999-11-01, released 2000-05-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-03, with a file datestamp of 2000-05-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.213
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.55: d1dazc_
  • Chain 'D':
    Domains in SCOP 1.55: d1dazd_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dazC (C:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpimiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dazD (D:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpimiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf