PDB entry 1d9t

View 1d9t on RCSB PDB site
Description: human glucosamine-6-phosphate deaminase isomerase at 1.75 a
Deposited on 1999-10-29, released 2000-10-30
The last revision prior to the SCOP 1.63 freeze date was dated 2000-10-30, with a file datestamp of 2000-10-30.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.205
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1d9ta_
  • Chain 'B':
    Domains in SCOP 1.63: d1d9tb_
  • Chain 'C':
    Domains in SCOP 1.63: d1d9tc_
  • Chain 'D':
    Domains in SCOP 1.63: d1d9td_
  • Chain 'E':
    Domains in SCOP 1.63: d1d9te_
  • Chain 'F':
    Domains in SCOP 1.63: d1d9tf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9tA (A:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9tB (B:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9tC (C:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9tD (D:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9tE (E:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9tF (F:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike