PDB entry 1d9k

View 1d9k on RCSB PDB site
Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca
Deposited on 1999-10-28, released 1999-12-15
The last revision prior to the SCOP 1.67 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.247
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kA (A:)
    qvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedgrf
    tiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kB (B:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kC (C:)
    ieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgg
    lqniatgkhnleiltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pei
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kD (D:)
    gserhfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeyw
    nkqylertraeldtvcrhnyektetptslrrleqpsvvislsrtealnhhntlvcsvtdf
    ypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslks
    pitvewra
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kE (E:)
    qvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedgrf
    tiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kF (F:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kG (G:)
    ieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgg
    lqniatgkhnleiltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pei
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kH (H:)
    gserhfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeyw
    nkqylertraeldtvcrhnyektetptslrrleqpsvvislsrtealnhhntlvcsvtdf
    ypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslks
    pitvewra