PDB entry 1d9a

View 1d9a on RCSB PDB site
Description: solution structure of the second RNA-binding domain (rbd2) of hu antigen c (huc)
Class: RNA binding protein
Keywords: RNA-BINDING DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA BINDING PROTEIN
Deposited on 1999-10-26, released 2000-04-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hu antigen c
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60900 (0-84)
  Domains in SCOPe 2.06: d1d9aa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d9aA (A:)
  danlyvsglpktmsqkemeqlfsqygriitsrilldqatgvsrgvgfirfdkrieaeeai
  kglngqkplgaaepitvkfannpsq