PDB entry 1d9a

View 1d9a on RCSB PDB site
Description: solution structure of the second rna-binding domain (rbd2) of hu antigen c (huc)
Deposited on 1999-10-26, released 2000-04-07
The last revision prior to the SCOP 1.61 freeze date was dated 2000-04-07, with a file datestamp of 2000-04-07.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1d9aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9aA (A:)
    danlyvsglpktmsqkemeqlfsqygriitsrilldqatgvsrgvgfirfdkrieaeeai
    kglngqkplgaaepitvkfannpsq