PDB entry 1d8u

View 1d8u on RCSB PDB site
Description: crystal structure of non-symbiotic plant hemoglobin from rice
Deposited on 1999-10-26, released 2001-01-10
The last revision prior to the SCOP 1.61 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1d8ua_
  • Chain 'B':
    Domains in SCOP 1.61: d1d8ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d8uA (A:)
    alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
    dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
    vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d8uB (B:)
    alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
    dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
    vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae