PDB entry 1d8l

View 1d8l on RCSB PDB site
Description: e. coli holliday junction binding protein ruva nh2 region lacking domain III
Class: gene regulation
Keywords: ob-fold, helix-hairpin-helix motif, gene regulation
Deposited on 1999-10-25, released 2000-05-03
The last revision prior to the SCOP 1.75 freeze date was dated 2000-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.247
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1d8la1, d1d8la2
  • Chain 'B':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1d8lb1, d1d8lb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d8lA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8lA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d8lB (B:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8lB (B:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlf