PDB entry 1d6p

View 1d6p on RCSB PDB site
Description: human lysozyme l63 mutant labelled with 2',3'-epoxypropyl n,n'-diacetylchitobiose
Class: hydrolase
Keywords: lysozyme, muramidase, hydrolase (o-glycosyl), site-directed mutagenesis, n,n'-diacetylchitobiose, affinity labeling
Deposited on 1999-10-15, released 2000-01-21
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.181
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00695 (0-129)
      • engineered (62)
    Domains in SCOP 1.73: d1d6pa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d6pA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srlwcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv