PDB entry 1d5x

View 1d5x on RCSB PDB site
Description:
Deposited on 1999-10-12, released 2000-06-28
The last revision prior to the SCOP 1.63 freeze date was dated 2000-06-28, with a file datestamp of 2000-06-28.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.237
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1d5xa1, d1d5xa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1d5xb1, d1d5xb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1d5xc1, d1d5xc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5xA (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d5xB (B:)
    gdtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaey
    wnsqkdlleqkraavdtycrhnygvgesftvqrrvypevtvypaktqplqhhnllvcsvn
    gfypgsievrwfrngqeektgvvstgliqngdwtfqtlvmletvprsgevytcqvehpsl
    tspltvewra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5xB (B:)
    gdtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaey
    wnsqkdlleqkraavdtycrhnygvgesftvqrrvypevtvypaknllvcsvngfypgsi
    evrwfrngqeektgvvstgliqngdwtfqtlvmletvprsgevytcqvehpsltspltve
    wra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d5xC (C:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh
    ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
    yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d5xC (C:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfsktcmyggvtehngnqldkyrsitvr
    vfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfienens
    fwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk