PDB entry 1d5a

View 1d5a on RCSB PDB site
Description: crystal structure of an archaebacterial dna polymerase d.tok. deposition of second native structure at 2.4 angstrom
Deposited on 1999-10-06, released 2000-03-24
The last revision prior to the SCOP 1.59 freeze date was dated 2000-03-24, with a file datestamp of 2000-03-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.253
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5aA (A:)
    mildadyitedgkpvirvfkkekgefkidydrdfepyiyallkddsaiedikkitaerhg
    ttvrvtraervkkkflgrpvevwklyfthpqdvpairdkirehpavvdiyeydipfakry
    lidrglipmegdeelrmlafdietlahagaaagagpilmisyadeegarvitwknidlpy
    vesvstekemikrflkviqekdpdvlityngdnfdfaylkkrsemlgvkfilgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytletvyepvfgqpaekvyaeeiaeawa
    sgeglervarysmedakatyelgkeffpmeaqlsrlvgqslwdvsrsstgnlvewfllrk
    ayerndvapnkpderelarrtesyaggyvkepekglwenivyldykslypsiiithnvsp
    dtlnregcreydvapqvghrfckdfpgfipsllgdlleerqkvkkkmkatvdpierklld
    yrqraikilansyygyyayanarwycrecaesvtawgrqyiettmreieekfgfkvlyad
    tdgffatipgadaetvknkakeflnyinprlpglleleyegfyrrgffvtkkkyavidee
    dkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevteklsrhevppekl
    viyeagphvaaaatvisyivlkgpgrvgdraipfdefdpakhrydaeyyienqvlpaver
    ilrafgyrkedlr