PDB entry 1d4y

View 1d4y on RCSB PDB site
Description: hiv-1 protease triple mutant/tipranavir complex
Deposited on 1999-10-06, released 1999-10-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-13, with a file datestamp of 1999-10-12.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.175
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d4ya_
  • Chain 'B':
    Domains in SCOP 1.55: d1d4yb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4yA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4yB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf