PDB entry 1d4w

View 1d4w on RCSB PDB site
Description: crystal structure of the xlp protein sap in complex with slam phosphopeptide
Deposited on 1999-10-06, released 1999-10-14
The last revision prior to the SCOP 1.61 freeze date was dated 2000-04-04, with a file datestamp of 2000-04-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1d4wa_
  • Chain 'B':
    Domains in SCOP 1.61: d1d4wb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4wA (A:)
    mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
    tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4wB (B:)
    avavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetg
    swsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek