PDB entry 1d4w

View 1d4w on RCSB PDB site
Description: crystal structure of the xlp protein sap in complex with slam phosphopeptide
Class: signaling protein
Keywords: sh2 domain, phosphotyrosine recogniiton, peptide recognition, signal transduction, lymphoproliferative disease, signaling protein
Deposited on 1999-10-06, released 1999-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t cell signal transduction molecule sap
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d4wa_
  • Chain 'B':
    Compound: t cell signal transduction molecule sap
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d4wb_
  • Chain 'C':
    Compound: signaling lymphocytic activation molecule
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13291 (Start-10)
      • modified residue (5)
  • Chain 'D':
    Compound: signaling lymphocytic activation molecule
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13291 (Start-10)
      • modified residue (5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4wA (A:)
    mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
    tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d4wB (B:)
    mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
    tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4wB (B:)
    avavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetg
    swsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.