PDB entry 1d4v

View 1d4v on RCSB PDB site
Description: Crystal structure of trail-DR5 complex
Class: apoptosis
Keywords: ligand-receptor complex, trimeric jelly-roll, tnf-r superfamily
Deposited on 1999-10-06, released 1999-11-01
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: death receptor 5
    Species: HOMO SAPIENS
    Gene: TRANSIENT EXPRESSION AS IG FUSION PROTEIN
    Database cross-references and differences (RAF-indexed):
    • GB AF012535 (1-116)
    Domains in SCOP 1.75: d1d4va1, d1d4va2, d1d4va3
  • Chain 'B':
    Compound: tnf-related apoptosis inducing ligand
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1d4vb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4vA (A:)
    pqqkrsspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelsp
    ctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhkesgd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4vB (B:)
    pqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihe
    kgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyg
    lysiyqggifelkendrifvsvtnehlidmdheasffgaflvg