PDB entry 1d4v

View 1d4v on RCSB PDB site
Description:
Deposited on 1999-10-06, released 1999-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-01, with a file datestamp of 1999-10-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d4va1, d1d4va2, d1d4va3
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d4vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4vA (A:)
    pqqkrsspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelsp
    ctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhkesgd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4vB (B:)
    pqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihe
    kgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyg
    lysiyqggifelkendrifvsvtnehlidmdheasffgaflvg