PDB entry 1d4t

View 1d4t on RCSB PDB site
Description: crystal structure of the xlp protein sap in complex with a slam peptide
Deposited on 1999-10-06, released 1999-10-14
The last revision prior to the SCOP 1.65 freeze date was dated 2000-04-10, with a file datestamp of 2000-04-10.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.127
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1d4ta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4tA (A:)
  mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
  tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek