PDB entry 1d4s

View 1d4s on RCSB PDB site
Description: hiv-1 protease v82f/i84v double mutant/tipranavir complex
Deposited on 1999-10-05, released 1999-10-12
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-12, with a file datestamp of 1999-10-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d4sa_
  • Chain 'B':
    Domains in SCOP 1.55: d1d4sb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4sA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpfnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4sB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpfnvigrnlltqigctlnf