PDB entry 1d4l
View 1d4l on RCSB PDB site
Description: hiv-1 protease complexed with a macrocyclic peptidomimetic inhibitor
Class: hydrolase
Keywords: hiv, protease, inhibitor, antiviral, structure
Deposited on
1999-10-04, released
2000-10-11
The last revision prior to the SCOP 1.73 freeze date was dated
2000-11-01, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (32)
- engineered (66)
- engineered (94)
Domains in SCOP 1.73: d1d4la_ - Chain 'B':
Compound: hiv-1 protease
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (32)
- engineered (66)
- engineered (94)
Domains in SCOP 1.73: d1d4lb_ - Heterogens: SO4, PI9, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1d4lA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1d4lB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf