PDB entry 1d4l

View 1d4l on RCSB PDB site
Description: hiv-1 protease complexed with a macrocyclic peptidomimetic inhibitor
Class: hydrolase
Keywords: hiv, protease, inhibitor, antiviral, structure
Deposited on 1999-10-04, released 2000-10-11
The last revision prior to the SCOP 1.73 freeze date was dated 2000-11-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (66)
    • engineered (94)
  Domains in SCOP 1.73: d1d4la_
• Chain 'B':
  Compound: hiv-1 protease
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (66)
    • engineered (94)
  Domains in SCOP 1.73: d1d4lb_
• Heterogens: SO4, PI9, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4lA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4lB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf