PDB entry 1d4l

View 1d4l on RCSB PDB site
Description: hiv-1 protease complexed with a macrocyclic peptidomimetic inhibitor
Deposited on 1999-10-04, released 2000-10-11
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d4la_
  • Chain 'B':
    Domains in SCOP 1.55: d1d4lb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d4lA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4lA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d4lB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4lB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf