PDB entry 1d4l

View 1d4l on RCSB PDB site
Description: hiv-1 protease complexed with a macrocyclic peptidomimetic inhibitor
Class: hydrolase
Keywords: hiv, protease, inhibitor, antiviral, hydrolase
Deposited on 1999-10-04, released 2000-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d1d4la_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d1d4lb_
  • Heterogens: SO4, PI9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4lA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4lB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf