PDB entry 1d3l

View 1d3l on RCSB PDB site
Description: d1d2-icam-1 fully glycosylated, variation of d1-d2 interdomain angle in different crystal structures.
Class: cell adhesion
Keywords: rhinovirus receptor, adhesion protein, glycoprotein, immunoglobulin fold, cell adhesion
Deposited on 1999-09-29, released 1999-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.371
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (intercellular adhesion molecule-1)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05362 (0-184)
  Domains in SCOPe 2.07: d1d3la1, d1d3la2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d3lA (A:)
  qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
  sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
  vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
  qlqtf