PDB entry 1d2q

View 1d2q on RCSB PDB site
Description:
Deposited on 1999-09-27, released 2000-02-11
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-11, with a file datestamp of 2000-02-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d2qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d2qA (A:)
    rvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihekg
    fyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeygly
    siyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2qA (A:)
    rvaahitgtrgnaasknekalgrkinswessghsflsnlhlrngelvihekgfyyiysqt
    yfrqmvqyiykytsypdpillmksarnscyglysiyqggifelkendrifvsvtnahaid
    mdheasffgaflvg