PDB entry 1d2m

View 1d2m on RCSB PDB site
Description: uvrb protein of thermus thermophilus hb8; a nucleotide excision repair enzyme
Deposited on 1999-09-25, released 2000-03-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-22, with a file datestamp of 2000-03-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.234
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d2mA (A:)
    tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
    pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
    sttrslltrrdvivvasvsaiyglgdpreyrarnlvvergkpyprevllerllelgyqrn
    didlspgrfrakgevleifpayetepirvelfgdeverisqvhpvtgerlrelpgfvlfp
    athylspegleeilkeiekelwervryfeergevlyaqrlkertlydlemlrvmgtcpgv
    enyaryftgkapgeppytlldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdygf
    rlpsaldnrplrfeeflervsqvvfvsatpgpfelahsgrvveqiirptglldplvrvkp
    tenqildlmegireraargertlvtvltvrmaeeltsflvehgirarylhheldafkrqa
    lirdlrlghydclvginllregldipevslvaildadkegflrsersliqtigraarnar
    gevwlyadrvseamqraieetnrrralqeaynlehgitpetv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2mA (A:)
    tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
    pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
    sttrslltrrdvivvasvsaiyglgdpreyrarnlvvrevllerllelgyqrndidlspg
    rfrakgevleifpayetepirvelgfvlfpathylspegleeilkeiekelwervryfee
    rgevlyaqrlkertlydlemlrvmgtcpgvenyaryftgkapgeppytlldyfpedflvf
    ldeshvtvpqlqgmyrgdyarkktlvdygfrlpsaldnrplrfeeflervsqvvfvsatp
    gpfelahsgrvveqiirptglldplvrvkptenqildlmegireraargertlvtvltvr
    maeeltsflvehgirarylhheldafkrqalirdlrlghydclvginllregldipevsl
    vaildadkegflrsersliqtigraarnargevwlyadrvseamqraieetnrrralqea
    ynlehgitpetv