PDB entry 1d2k

View 1d2k on RCSB PDB site
Description: c. immitis chitinase 1 at 2.2 angstroms resolution
Class: hydrolase
Keywords: beta-alpha barrel
Deposited on 1999-09-23, released 2000-09-27
The last revision prior to the SCOP 1.73 freeze date was dated 2000-09-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase 1
    Species: Coccidioides immitis
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1d2ka1, d1d2ka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2kA (A:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgididweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps