PDB entry 1d2e

View 1d2e on RCSB PDB site
Description: crystal structure of mitochondrial ef-tu in complex with GDP
Class: RNA binding protein
Keywords: g-protein, beta-barrel, RNA binding protein
Deposited on 1999-09-23, released 1999-09-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.237
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu (ef-tu)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d2ea1, d1d2ea2, d1d2ea3
  • Chain 'B':
    Compound: elongation factor tu (ef-tu)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d2eb1, d1d2eb2, d1d2eb3
  • Chain 'C':
    Compound: elongation factor tu (ef-tu)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d2ec1, d1d2ec2, d1d2ec3
  • Chain 'D':
    Compound: elongation factor tu (ef-tu)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d2ed1, d1d2ed2, d1d2ed3
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2eA (A:)
    kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
    ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
    hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
    svqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflg
    hsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakpgsiqphqkvea
    qvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltlilrqpm
    ilekgqrftlrdgnrtigtglvtdtpamteedknikw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2eB (B:)
    kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
    ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
    hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
    svqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflg
    hsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakpgsiqphqkvea
    qvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltlilrqpm
    ilekgqrftlrdgnrtigtglvtdtpamteedknikw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2eC (C:)
    kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
    ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
    hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
    svqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflg
    hsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakpgsiqphqkvea
    qvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltlilrqpm
    ilekgqrftlrdgnrtigtglvtdtpamteedknikw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2eD (D:)
    kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
    ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
    hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
    svqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflg
    hsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakpgsiqphqkvea
    qvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltlilrqpm
    ilekgqrftlrdgnrtigtglvtdtpamteedknikw