PDB entry 1d1n

View 1d1n on RCSB PDB site
Description: solution structure of the fmet-trnafmet binding domain of becillus stearothermophillus translation initiation factor if2
Deposited on 1999-09-20, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d1na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1nA (A:)
    yeekvigqaevrqtfkvskvgtiagcyvtdgkitrdskvrlirqgivvyegeidslkryk
    ddvrevaqgyecgltiknfndikegdvieayvmqevara