PDB entry 1d0g

View 1d0g on RCSB PDB site
Description: crystal structure of death receptor 5 (dr5) bound to apo2l/trail
Class: apoptosis
Keywords: apoptosis, binding and specificity, ligand-receptor complex, tnf receptor family
Deposited on 1999-09-09, released 1999-10-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis-2 ligand
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1d0ga_
  • Chain 'B':
    Compound: apoptosis-2 ligand
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1d0gb_
  • Chain 'D':
    Compound: apoptosis-2 ligand
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1d0gd_
  • Chain 'R':
    Compound: death receptor-5
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1d0gr1, d1d0gr2, d1d0gr3
  • Chain 'S':
    Compound: death receptor-5
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1d0gs1, d1d0gs2, d1d0gs3
  • Chain 'T':
    Compound: death receptor-5
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1d0gt1, d1d0gt2, d1d0gt3
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d0gA (A:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0gA (A:)
    pqrvaahitgtrgekalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqtyf
    rfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggifel
    kendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d0gB (B:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0gB (B:)
    pqrvaahitgtrgekalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqtyf
    rfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggifel
    kendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d0gD (D:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0gD (D:)
    pqrvaahitgtrgekalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqtyf
    rfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggifel
    kendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1d0gR (R:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0gR (R:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1d0gS (S:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0gS (S:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhkes
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1d0gT (T:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0gT (T:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhkes