PDB entry 1cyx

View 1cyx on RCSB PDB site
Description: quinol oxidase (periplasmic fragment of subunit II with engineered cu-a binding site)(cyoa)
Class: electron transport
Keywords: electron transport
Deposited on 1995-08-22, released 1996-03-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyoa
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABJ1
      • engineered (61)
      • engineered (96)
      • engineered (98-100)
      • engineered (104)
    Domains in SCOPe 2.05: d1cyxa_
  • Heterogens: CUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cyxA (A:)
    thalepskplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsv
    mhsffiprlgsqiyamagmqtrlhlianepgtydgicaeicgpghsgmkfkaiatpdraa
    fdqwvakakqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfmahgksmdm
    tqpegehsahegmegmdmshaesah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cyxA (A:)
    kpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmhsffiprlgsqiy
    amagmqtrlhlianepgtydgicaeicgpghsgmkfkaiatpdraafdqwvakakqspnt
    msdmaafeklaapseynqveyfsnvkpdlfadvinkfm