PDB entry 1cyw

View 1cyw on RCSB PDB site
Description: quinol oxidase (periplasmic fragment of subunit II) (cyoa)
Class: electron transport
Keywords: electron transport
Deposited on 1995-08-22, released 1996-03-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyoa
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1cywa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cywA (A:)
    thalepskplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsv
    mnsffiprlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraa
    fdqwvakakqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfmahgksmdm
    tqpegehsahegmegmdmshaesah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cywA (A:)
    kpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffiprlgsqiy
    amagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvakakqspnt
    msdmaafeklaapseynqveyfsnvkpdlfadvinkfma