PDB entry 1cyw

View 1cyw on RCSB PDB site
Description: quinol oxidase (periplasmic fragment of subunit ii) (cyoa)
Deposited on 1995-08-22, released 1996-03-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1cyw__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cyw_ (-)
    kpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffiprlgsqiy
    amagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvakakqspnt
    msdmaafeklaapseynqveyfsnvkpdlfadvinkfma