PDB entry 1cyj

View 1cyj on RCSB PDB site
Description: cytochrome c6
Class: electron transport protein (cytochrome)
Keywords: photosynthesis, chlamydomonas, electron transport protein (cytochrome)
Deposited on 1995-05-09, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cyja_
  • Heterogens: CD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cyjA (A:)
    adlalgaqvfngncaachmggrnsvmpektldkaaleqyldggfkvesiiyqvengkgam
    pawadrlseeeiqavaeyvfkqatdaawky