PDB entry 1cyj

View 1cyj on RCSB PDB site
Description: cytochrome c6
Deposited on 1995-05-09, released 1996-01-29
The last revision prior to the SCOP 1.59 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1cyj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cyj_ (-)
adlalgaqvfngncaachmggrnsvmpektldkaaleqyldggfkvesiiyqvengkgam
pawadrlseeeiqavaeyvfkqatdaawky