PDB entry 1cyc

View 1cyc on RCSB PDB site
Description: the crystal structure of bonito (katsuo) ferrocytochrome c at 2.3 angstroms resolution. II. structure and function
Class: electron transport
Keywords: electron transport
Deposited on 1976-08-01, released 1976-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferrocytochrome c
    Species: Katsuwonus pelamis [TaxId:8226]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cyca_
  • Chain 'B':
    Compound: ferrocytochrome c
    Species: Katsuwonus pelamis [TaxId:8226]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cycb_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cycA (A:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cycB (B:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats