PDB entry 1cxz

View 1cxz on RCSB PDB site
Description: crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1
Class: signaling protein
Keywords: protein-protein complex, antiparallel coiled-coil, signaling protein
Deposited on 1999-08-31, released 1999-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (his-tagged transforming protein rhoa(0-181))
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61586 (0-181)
      • enginerred mutation (14)
      • insertion; see remark 999 (0)
    Domains in SCOPe 2.07: d1cxza_
  • Chain 'B':
    Compound: protein (pkn)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cxzb_
  • Heterogens: MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxzA (A:)
    smaairkklvivgdvacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwd
    tagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkk
    dlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal
    qa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxzB (B:)
    wslleqlglagadlaapgvqqqlelererlrreirkelklkegaenlrrattdlgrslgp
    velllrgssrrldllhqqlqelhahv