PDB entry 1cxw

View 1cxw on RCSB PDB site
Description: the second type II module from human matrix metalloproteinase 2
Class: hydrolase
Keywords: beta sheet, alpha helix, hydrolase
Deposited on 1999-08-31, released 1999-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human matrix metalloproteinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08253 (1-59)
      • expression artifact (0)
    Domains in SCOPe 2.08: d1cxwa1, d1cxwa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxwA (A:)
    talftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpeta