PDB entry 1cxa

View 1cxa on RCSB PDB site
Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms
Class: electron transport (cytochrome)
Keywords: electron transport (cytochrome)
Deposited on 1994-02-14, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c2
  Species: Rhodobacter sphaeroides [TaxId:1063]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00095 (0-123)
  Domains in SCOPe 2.08: d1cxaa_
• Heterogens: IMD, HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cxaA (A:)
  qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
  mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
  avrp