PDB entry 1cx8

View 1cx8 on RCSB PDB site
Description:
Deposited on 1999-08-28, released 1999-09-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-23, with a file datestamp of 2000-05-23.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.243
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8A (A:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8B (B:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8C (C:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8D (D:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8E (E:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8F (F:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8G (G:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8H (H:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef