PDB entry 1cx8

View 1cx8 on RCSB PDB site
Description: crystal structure of the ectodomain of human transferrin receptor
Class: metal transport
Keywords: human transferrin receptor, metal transport
Deposited on 1999-08-28, released 1999-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transferrin receptor protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cx8a1, d1cx8a2, d1cx8a3
  • Chain 'B':
    Compound: transferrin receptor protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cx8b1, d1cx8b2, d1cx8b3
  • Chain 'C':
    Compound: transferrin receptor protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cx8c1, d1cx8c2, d1cx8c3
  • Chain 'D':
    Compound: transferrin receptor protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cx8d1, d1cx8d2, d1cx8d3
  • Chain 'E':
    Compound: transferrin receptor protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cx8e1, d1cx8e2, d1cx8e3
  • Chain 'F':
    Compound: transferrin receptor protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cx8f1, d1cx8f2, d1cx8f3
  • Chain 'G':
    Compound: transferrin receptor protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cx8g1, d1cx8g2, d1cx8g3
  • Chain 'H':
    Compound: transferrin receptor protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cx8h1, d1cx8h2, d1cx8h3
  • Heterogens: NAG, SM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8A (A:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8B (B:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8C (C:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8D (D:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8E (E:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8F (F:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8G (G:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cx8H (H:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef