PDB entry 1cwc

View 1cwc on RCSB PDB site
Description: improved binding affinity for cyclophilin a by a cyclosporin derivative singly modified at its effector domain
Deposited on 1995-09-06, released 1996-01-29
The last revision prior to the SCOP 1.55 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cwca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cwcA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle