PDB entry 1cvj

View 1cvj on RCSB PDB site
Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna
Deposited on 1999-08-23, released 1999-10-04
The last revision prior to the SCOP 1.57 freeze date was dated 1999-11-05, with a file datestamp of 1999-11-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cvjA (A:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrker
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cvjB (B:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjB (B:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcskgygfvhfetqeaaeraiekmnvgrfks
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cvjC (C:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cvjD (D:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjD (D:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcskgygfvhfetqeaaeraiekmngmllndrkvfvgrfks
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cvjE (E:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1cvjF (F:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjF (F:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgninkalydtfsafgnilsckvvcskgygfvh
    fetqevfvgrf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cvjG (G:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfks
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1cvjH (H:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjH (H:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifikalydtfsafgnilsckvvcskgygfv
    hfetqeaaefks