PDB entry 1cvi

View 1cvi on RCSB PDB site
Description: crystal structure of human prostatic acid phosphatase
Deposited on 1999-08-23, released 1999-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2000-04-07, with a file datestamp of 2000-04-07.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.157
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1cvia_
  • Chain 'B':
    Domains in SCOP 1.69: d1cvib_
  • Chain 'C':
    Domains in SCOP 1.69: d1cvic_
  • Chain 'D':
    Domains in SCOP 1.69: d1cvid_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cviA (A:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cviB (B:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cviC (C:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cviD (D:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt